Loading...
Statistics
Advertisement

Welcome to Cat9Sound - Cat9sound
www.cat9sound.com/

Cat9sound.com

Advertisement
Conversion Technology Metas Server
Cat9sound.com is hosted in United States / San Francisco . Cat9sound.com uses HTTPS protocol. Number of used technologies: 7. First technologies: CSS, Html, Html5, Number of used javascripts: 5. First javascripts: Jquery.min.js, Stl.js, Main.js, Number of used analytics tools: 2. First analytics tools: Google Analytics, Quantcast Measurement, Its server type is: Apache. Its CMS is: Webly.

Technologies in use by Cat9sound.com

Technology

Number of occurences: 7
  • CSS
  • Html
  • Html5
  • Iframe
  • Javascript
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 5
  • jquery.min.js
  • stl.js
  • main.js
  • footerSignup.js

Content Management System

Number of occurences: 1
  • Webly

Analytics

Number of occurences: 2
  • Google Analytics
  • Quantcast Measurement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Cat9sound.com

SSL certificate

    • name: /1.3.6.1.4.1.311.60.2.1.3=US/1.3.6.1.4.1.311.60.2.1.2=Delaware/C=US/ST=California/L=San Francisco/businessCategory=Private Organization/serialNumber=4277212/O=Weebly, Inc./OU=Web Services/CN=www.weebly.com
    • subject:
      • UNDEF:
        • 0: US
        • 1: Delaware
      • C: US
      • ST: California
      • L: San Francisco
      • businessCategory: Private Organization
      • serialNumber: 4277212
      • O: Weebly, Inc.
      • OU: Web Services
      • CN: www.weebly.com
    • hash: 0759ea11
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: GeoTrust EV SSL CA - G4
    • version: 2
    • serialNumber: 163074596613821496350127820494981326711
    • validFrom: 140930000000Z
    • validTo: 160922235959Z
    • validFrom_time_t: 1412035200
    • validTo_time_t: 1474588799
    • extensions:
      • subjectAltName: DNS:mobileapi.weebly.com, DNS:secure.weebly.com, DNS:ssl.weebly.com, DNS:weebly.com, DNS:www.weebly.com
      • basicConstraints: CA:FALSE
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://gm.symcb.com/gm.crl
      • certificatePolicies: Policy: 1.3.6.1.4.1.14370.1.6 CPS: https://www.geotrust.com/resources/repository/legal User Notice: Explicit Text: https://www.geotrust.com/resources/repository/legal
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • authorityKeyIdentifier: keyid:DE:CF:5C:50:B7:AE:02:1F:15:17:AA:16:E8:0D:B5:28:9D:6A:5A:F3
      • authorityInfoAccess: OCSP - URI:http://gm.symcd.com CA Issuers - URI:http://gm.symcb.com/gm.crt

Meta - Cat9sound.com

Number of occurences: 1
  • Name:
    Content: text/html; charset=utf-8

Server / Hosting

  • IP: 199.34.228.59
  • Latitude: 37.77
  • Longitude: -122.39
  • Country: United States
  • City: San Francisco

Rname

  • ns41.domaincontrol.com
  • ns42.domaincontrol.com
  • smtp.secureserver.net
  • mailstore1.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Wed, 11 May 2016 01:18:26 GMT Server: Apache Location: http://www.cat9sound.com/ Vary: Accept-Encoding Content-Type: text/html; charset=iso-8859-1 X-W-DC: SFO X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive HTTP/1.1 200 OK Date: Wed, 11 May 2016 01:18:26 GMT Server: Apache Set-Cookie: is_mobile=0; path=/; domain=www.cat9sound.com Set-Cookie: language=en; expires=Wed, 25-May-2016 01:18:26 GMT; Max-Age=1209600; path=/ Cache-Control: private ETag: W/"c976707b6b506708adb5954f6fdcd10d" Vary: Accept-Encoding,User-Agent X-Host: pages20.sf2p.intern.weebly.net X-UA-Compatible: IE=edge,chrome=1 Content-Type: text/html; charset=UTF-8 X-W-DC: SFO X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive

DNS

host: cat9sound.com
  1. class: IN
  2. ttl: 3599
  3. type: A
  4. ip: 199.34.228.59
host: cat9sound.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns41.domaincontrol.com
host: cat9sound.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns42.domaincontrol.com
host: cat9sound.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns41.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016050400
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 600
host: cat9sound.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: smtp.secureserver.net
host: cat9sound.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mailstore1.secureserver.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.at9sound.com, www.cdat9sound.com, www.dat9sound.com, www.crat9sound.com, www.rat9sound.com, www.ctat9sound.com, www.tat9sound.com, www.cvat9sound.com, www.vat9sound.com, www.cfat9sound.com, www.fat9sound.com, www.cgat9sound.com, www.gat9sound.com, www.hat9sound.com, www.cnat9sound.com, www.nat9sound.com, www.cmat9sound.com, www.mat9sound.com, www.cjat9sound.com, www.jat9sound.com, www.ct9sound.com, www.caot9sound.com, www.cot9sound.com, www.capt9sound.com, www.cpt9sound.com, www.ca9t9sound.com, www.c9t9sound.com, www.cat9sound.com, www.ct9sound.com, www.cait9sound.com, www.cit9sound.com, www.caut9sound.com, www.cut9sound.com, www.ca9sound.com, www.catq9sound.com, www.caq9sound.com, www.cata9sound.com, www.caa9sound.com, www.cat 9sound.com, www.ca 9sound.com, www.catw9sound.com, www.caw9sound.com, www.cate9sound.com, www.cae9sound.com, www.catz9sound.com, www.caz9sound.com, www.catx9sound.com, www.cax9sound.com, www.catc9sound.com, www.cac9sound.com, www.catsound.com, www.cat9usound.com, www.catusound.com, www.cat9osound.com, www.catosound.com, www.cat9isound.com, www.catisound.com, www.cat97sound.com, www.cat7sound.com, www.cat9ound.com, www.cat9seound.com, www.cat9eound.com, www.cat9swound.com, www.cat9wound.com, www.cat9sdound.com, www.cat9dound.com, www.cat9sxound.com, www.cat9xound.com, www.cat9sfound.com, www.cat9found.com, www.cat9sgound.com, www.cat9gound.com, www.cat9stound.com, www.cat9tound.com, www.cat9sund.com, www.cat9sobund.com, www.cat9sbund.com, www.cat9sohund.com, www.cat9shund.com, www.cat9sogund.com, www.cat9sgund.com, www.cat9sojund.com, www.cat9sjund.com, www.cat9somund.com, www.cat9smund.com, www.cat9so und.com, www.cat9s und.com, www.cat9sovund.com, www.cat9svund.com, www.cat9sond.com, www.cat9souwnd.com, www.cat9sownd.com, www.cat9souend.com, www.cat9soend.com, www.cat9sousnd.com, www.cat9sosnd.com, www.cat9souand.com, www.cat9soand.com, www.cat9soud.com, www.cat9sounnd.com, www.cat9sound.com, www.cat9sounhd.com, www.cat9souhd.com, www.cat9sounjd.com, www.cat9soujd.com, www.cat9sounkd.com, www.cat9soukd.com, www.cat9sounld.com, www.cat9sould.com, www.cat9soun d.com, www.cat9sou d.com, www.cat9soun.com, www.cat9soundt.com, www.cat9sount.com, www.cat9soundg.com, www.cat9soung.com, www.cat9soundb.com, www.cat9sounb.com, www.cat9soundx.com, www.cat9sounx.com, www.cat9sounds.com, www.cat9souns.com, www.cat9soundf.com, www.cat9sounf.com, www.cat9soundv.com, www.cat9sounv.com, www.cat9soundy.com, www.cat9souny.com, www.cat9soundz.com, www.cat9sounz.com, www.cat9sounda.com, www.cat9souna.com, www.cat9sounde.com, www.cat9soune.com, www.cat9soundr.com, www.cat9sounr.com,

Other websites we recently analyzed

  1. Figulinas: Home
    Associazione Culturale Gruppo Folk Figulinas, di FLORINAS
    Germany - 217.160.230.187
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 7
    Number of meta tags: 6
  2. Stellar Publishing e-Store
    Houston (United States) - 192.185.170.161
    Server software: nginx/1.10.1
    Technology: Html, Php
    Number of meta tags: 1
  3. DPMCUSA | Best Credit Repair | New York | New Jersey | Pennsylvania
    Best Credit Repair Serving New York Buffalo Albany Jersey City Newark Pittsburgh & Philadelphia. Services Nationwide. Get the Best Results. A+ Rating.
    Burlington (United States) - 66.96.161.132
    Server software: Apache/2
    Technology: CSS, Google Font API, Javascript
    Number of Javascript: 3
    Number of meta tags: 5
  4. Willkommen bei PPE-Trading
    Zurich (Switzerland) - 217.26.52.41
    Server software: Apache/2.4
    Technology: CSS, Html
    Number of meta tags: 10
  5. J Collins Kerr | www.jcollinskerr.com | Home
    Beaverton (United States) - 67.51.200.171
    Server software:
    Technology: CSS, Html, Javascript, jQuery UI, Share This Social Media Buttons
    Number of Javascript: 9
    Number of meta tags: 3
  6. valentinesdaywishesmessagespics.com
    Scottsdale (United States) - 104.238.72.112
    Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  7. Kumruoğlu Nakliyat Lojistik Ambarcılık - www.kumruoglu.com.tr
    Kumruoğlu Nakliyat Lojistik Ambarcılık
    Turkey - 94.73.147.80
    Server software: nginx/1.1.19
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery UI
    Number of Javascript: 21
    Number of meta tags: 2
  8. giovannimurray.com
    Wayne (United States) - 74.208.165.84
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  9. W-Didacte.be
    Denmark - 46.30.212.21
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  10. your-coaching-concept.net
    Hier entsteht
    Germany - 89.31.143.16
    Server software: Apache
    Technology: CSS, Html, SVG
    Number of meta tags: 3

Check Other Websites